TA337889 GREB1 antibody

Rabbit Polyclonal Anti-GREB1 Antibody

See related secondary antibodies

Search for all "GREB1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish GREB1

Product Description for GREB1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish GREB1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GREB1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Gene regulated in breast cancer 1 protein, KIAA0575
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q4ZG55
Immunogen:
The immunogen for anti-GREB1 antibody is: synthetic peptide directed towards the N-terminal region of Human GREB1. Synthetic peptide located within the following region: MGNSYAGQLKTTRFEEVLHNSIEASLRSNNLVPRPIFSQLYLEAEQQLAA.
GeneID:
9687
Application WB
Background This gene is an estrogen-responsive gene that is an early response gene in the estrogen receptor-regulated pathway. It is thought to play an important role in hormone-responsive tissues and cancer. Three altertively spliced transcript variants encoding distinct isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for GREB1 (4 products)

Catalog No. Species Pres. Purity   Source  

GREB1 Lysate

Western Blot: GREB1 Lysate [NBL1-11329] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for GREB1
  Novus Biologicals Inc.

GREB1 overexpression lysate

GREB1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

GREB1 overexpression lysate

GREB1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

GREB1 overexpression lysate

GREB1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn