TA337933 DIDO1 antibody

Rabbit Polyclonal Anti-DIDO1 Antibody

See related secondary antibodies

Search for all "DIDO1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast DIDO1

Product Description for DIDO1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Yeast DIDO1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DIDO1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C20orf158, DATF1, Death-inducer obliterator 1, KIAA0333
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ye
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BTC0
Immunogen:
The immunogen for anti-DIDO1 antibody: synthetic peptide directed towards the N terminal of human DIDO1. Synthetic peptide located within the following region: ERVEQFLTIARRRGRRSMPVSLEDSGEPTSCPATDAETASEGSVESASET.
GeneID:
11083
Application WB
Background Apoptosis, a major form of cell death, is an efficient mechanism for elimiting unwanted cells and is of central importance for development and homeostasis in metazoan animals. In mice, the death inducer-obliterator-1 gene is upregulated by apoptotic sigls and encodes a cytoplasmic protein that translocates to the nucleus upon apoptotic sigl activation. When overexpressed, the mouse protein induced apoptosis in cell lines growing in vitro. This gene is similar to the mouse gene and therefore is thought to be involved in apoptosis. Altertively spliced transcripts have been found for this gene, encoding multiple isoforms. [provided by RefSeq, Jul 2008].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DIDO1 (4 products)

Catalog No. Species Pres. Purity   Source  

DIDO1

DIDO1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DIDO1

DIDO1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

DIDO1

DIDO1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DIDO1

DIDO1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for DIDO1 (1 products)

Catalog No. Species Pres. Purity   Source  

DIDO1 293T Cell Transient Overexpression Lysate(Denatured)

DIDO1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn