TA337948 TRIM14 antibody

Rabbit Polyclonal Anti-TRIM14 Antibody

See related secondary antibodies

Search for all "TRIM14"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human TRIM14

Product Description for TRIM14

Rabbit anti Human TRIM14.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for TRIM14

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA0129, Tripartite motif-containing protein 14
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q14142
Immunogen:
The immunogen for anti-TRIM14 antibody: synthetic peptide directed towards the middle region of human TRIM14. Synthetic peptide located within the following region: SFEPVKSFFKGLVEAVESTLQTPLDIRLSPTNHAYSALKVSSPRLVSNRP.
GeneID:
9830
Application WB
Background TRIM14 is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been determined. Four altertively spliced transcript variants for this gene have been describedThe protein encoded by this gene is a member of the tripartite motif (TRIM) family. The TRIM motif includes three zinc-binding domains, a RING, a B-box type 1 and a B-box type 2, and a coiled-coil region. The protein localizes to cytoplasmic bodies and its function has not been determined. Four altertively spliced transcript variants for this gene have been described.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for TRIM14 (3 products)

Catalog No. Species Pres. Purity   Source  

TRIM14

TRIM14 Human
  Abnova Taiwan Corp.

TRIM14

TRIM14 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

TRIM14

TRIM14 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for TRIM14 (1 products)

Catalog No. Species Pres. Purity   Source  

TRIM14 293T Cell Transient Overexpression Lysate(Denatured)

TRIM14 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn