TA337949 SEC16B antibody

Rabbit Polyclonal Anti-SEC16B Antibody

See related secondary antibodies

Search for all "SEC16B"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human SEC16B

Product Description for SEC16B

Rabbit anti Bovine, Human SEC16B.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for SEC16B

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms KIAA1928, LZTR2, Leucine zipper transcription regulator 2, Protein SEC16 homolog B, Protein transport protein Sec16B, RGPR, RGPR-p117, Regucalcin gene promoter region-related protein p117, SEC16B, SEC16S
Presentation Purified
Reactivity Bov, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96JE7
Immunogen:
The immunogen for anti-SEC16B antibody is: synthetic peptide directed towards the C-terminal region of Human SEC16B. Synthetic peptide located within the following region: KSSGFGWFSWFRSKPTKNASPAGDEDSSDSPDSEETPRASSPHQAGLGLS.
GeneID:
89866
Application WB
Background SEC16B is a mammalian homolog of S. cerevisiae Sec16 that is required for organization of transitiol endoplasmic reticulum (ER) sites and protein export.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for SEC16B (2 products)

Catalog No. Species Pres. Purity   Source  

SEC16B

SEC16B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

SEC16B

SEC16B Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for SEC16B (2 products)

Catalog No. Species Pres. Purity   Source  

LZTR2 293T Cell Transient Overexpression Lysate(Denatured)

LZTR2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SEC16B overexpression lysate

SEC16B overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn