TA337965 CHMP5 antibody

Rabbit Polyclonal Anti-Chmp5 Antibody

See related secondary antibodies

Search for all "CHMP5"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish CHMP5

Product Description for CHMP5

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish CHMP5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CHMP5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C9orf83, CHMP-5, Charged multivesicular body protein 5, Chromatin-modifying protein 5, SNF7 domain-containing protein 2, SNF7DC2, Vacuolar protein-sorting-associated protein 60, Vps60, hVps60
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9D7S9
Immunogen:
The immunogen for anti-Chmp5 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Chmp5. Synthetic peptide located within the following region: LDALGDELLADEDSSYLDEAASAPAIPEGVPTDTKNKDGVLVDEFGLPQI.
GeneID:
76959
Application WB
Background Chmp5 is a probable peripherally associated component of the endosomal sorting required for transport complex III (ESCRT-III) which is involved in multivesicular bodies (MVBs) formation and sorting of endosomal cargo proteins into MVBs. MVBs contain intralumil vesicles (ILVs) that are generated by invagition and scission from the limiting membrane of the endosome and mostly are delivered to lysosomes ebling degradation of membrane proteins, such as stimulated growth factor receptors, lysosomal enzymes and lipids. The MVB pathway appears to require the sequential function of ESCRT-O, -I,-II and -III complexes. ESCRT-III proteins mostly dissociate from the invagiting membrane before the ILV is released. The ESCRT machinery also functions in topologically equivalent membrane fission events, such as the termil stages of cytokinesis. ESCRT-III proteins are believed to mediate the necessary vesicle extrusion and/or membrane fission activities, possibly in conjunction with the AAA ATPase VPS4.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn