TA337970 ASPRV1 / SASP antibody

Rabbit Polyclonal Anti-Asprv1 Antibody

See related secondary antibodies

Search for all "ASPRV1 / SASP"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ASPRV1 / SASP

Product Description for ASPRV1 / SASP

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat ASPRV1 / SASP.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ASPRV1 / SASP

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Retroviral-like aspartic protease 1, SASPase, Skin aspartic protease, Skin-specific retroviral-like aspartic protease, TAPS, TPA-inducible aspartic proteinase-like protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q09PK2
Immunogen:
The immunogen for anti-Asprv1 antibody is: synthetic peptide directed towards the middle region of Mouse Asprv1. Synthetic peptide located within the following region: DVLQDHNAVLDFEHRTCTLKGKKFRLLPVGSSLEDEFDLELIEEEEESSA.
GeneID:
67855
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn