TA338017 Macrophage stimulatory protein antibody

Rabbit Polyclonal Anti-MST1 Antibody

See related secondary antibodies

Search for all "Macrophage stimulatory protein"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Macrophage stimulatory protein

Product Description for Macrophage stimulatory protein

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Macrophage stimulatory protein.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Macrophage stimulatory protein

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms D3F15S2, DNF15S2, HGFL, Hepatocyte growth factor-like protein, Hepatocyte growth factor-like protein alpha chain, Hepatocyte growth factor-like protein beta chain, MSP, MST1, Macrophage-stimulating protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P26927
Immunogen:
The immunogen for anti-MST1 antibody is: synthetic peptide directed towards the N-terminal region of Human MST1. Synthetic peptide located within the following region: TQCLGVPGQRSPLNDFQVLRGTELQHLLHAVVPGPWQEDVADAEECAGRC.
GeneID:
4485
Application WB
Background The protein encoded by this gene contains four kringle domains and a serine protease domain, similar to that found in hepatic growth factor. Despite the presence of the serine protease domain, the encoded protein may not have any proteolytic activity. The receptor for this protein is RON tyrosine kise, which upon activation stimulates ciliary motility of ciliated epithelial lung cells. This protein is secreted and cleaved to form an alpha chain and a beta chain bridged by disulfide bonds. [provided by RefSeq, Jan 2010].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Macrophage stimulatory protein (5 products)

Catalog No. Species Pres. Purity   Source  

Macrophage stimulatory protein

Macrophage stimulatory protein Human > 80 %
Preparation: or Add: Recombint proteins was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Macrophage stimulatory protein

Macrophage stimulatory protein Human Purified
  Abnova Taiwan Corp.

Macrophage stimulatory protein

Macrophage stimulatory protein Human Purified
  Abnova Taiwan Corp.

Macrophage stimulatory protein

Macrophage stimulatory protein Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Macrophage stimulatory protein

Macrophage stimulatory protein Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Macrophage stimulatory protein (1 products)

Catalog No. Species Pres. Purity   Source  

MST1 293T Cell Transient Overexpression Lysate(Denatured)

MST1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn