TA338027 STARD7 antibody

Rabbit Polyclonal Anti-STARD7 Antibody

See related secondary antibodies

Search for all "STARD7"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Canine, Equine, Human, Porcine STARD7

Product Description for STARD7

Rabbit anti Canine, Equine, Human, Porcine STARD7.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for STARD7

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GTT1, Gestational trophoblastic tumor protein 1, START domain-containing protein 7, StAR-related lipid transfer protein 7 mitochondrial
Presentation Purified
Reactivity Can, Eq, Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NQZ5
Immunogen:
The immunogen for anti-STARD7 antibody is: synthetic peptide directed towards the N-terminal region of Human STARD7. Synthetic peptide located within the following region: SINEMKRLEEMSNMFQSSGVQHHPPEPKAQTEGNEDSEGKEQRWEMVMDK.
GeneID:
56910
Application WB
Background Although the function of this gene is not known, its existence is supported by mR and EST data. The predicted gene product contains a region similar to the STAR-related lipid transfer (START) domain, which is often present in proteins involved in the cell sigling mediated by lipid binding. Altertively spliced transcript variants have been described, although some transcripts occur only in cancer cell lines.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for STARD7 (3 products)

Catalog No. Species Pres. Purity   Source  

STARD7

STARD7 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

STARD7

STARD7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

STARD7

STARD7 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for STARD7 (3 products)

Catalog No. Species Pres. Purity   Source  

STARD7 overexpression lysate

STARD7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

START domain containing 7 Lysate

Western Blot: START domain containing 7 Lysate [NBL1-16521] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for STARD7
  Novus Biologicals Inc.

START domain containing 7 Lysate

Western Blot: START domain containing 7 Lysate [NBL1-16522] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for STARD7
  Novus Biologicals Inc.
  • LinkedIn