TA338033 CD172g / SIRPG antibody

Rabbit Polyclonal Anti-SIRPG Antibody

See related secondary antibodies

Search for all "CD172g / SIRPG"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Equine, Human CD172g / SIRPG

Product Description for CD172g / SIRPG

Rabbit anti Bovine, Equine, Human CD172g / SIRPG.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CD172g / SIRPG

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CD172 antigen-like family member B, SIRP gamma, SIRP-b2, SIRP-beta-2, SIRPB2, Signal-regulatory protein beta-2, Signal-regulatory protein gamma
Presentation Purified
Reactivity Bov, Eq, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9P1W8
Immunogen:
The immunogen for anti-SIRPG antibody is: synthetic peptide directed towards the middle region of Human SIRPG. Synthetic peptide located within the following region: MDFSIRISSITPADVGTYYCVKFRKGSPENVEFKSGPGTEMALGAKPSA.
GeneID:
55423
Application WB
Background The protein encoded by this gene is a member of the sigl-regulatory protein (SIRP) family, and also belongs to the immunoglobulin superfamily. SIRP family members are receptor-type transmembrane glycoproteins known to be involved in the negative regulation of receptor tyrosine kise-coupled sigling processes. Altertively spliced transcript variants encoding different isoforms have been described.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CD172g / SIRPG (4 products)

Catalog No. Species Pres. Purity   Source  

CD172g / SIRPG (transcript variant 1)

CD172g / SIRPG Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €299.00
  OriGene Technologies, Inc.

CD172g / SIRPG (His-tag)

CD172g / SIRPG Human Purified > 80 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

CD172g / SIRPG (His-tag)

CD172g / SIRPG Human Purified > 80 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

CD172g / SIRPG

CD172g / SIRPG Human
  Abnova Taiwan Corp.

Positive controls for CD172g / SIRPG (5 products)

Catalog No. Species Pres. Purity   Source  

CD172 gamma Lysate

Western Blot: CD172 gamma Lysate [NBL1-15972] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for SIRPG
  Novus Biologicals Inc.

SIRPG 293T Cell Transient Overexpression Lysate(Denatured)

SIRPG 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

SIRPG overexpression lysate

SIRPG overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SIRPG overexpression lysate

SIRPG overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

SIRPG overexpression lysate

SIRPG overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn