TA338122 LILRA1 / CD85i antibody

Rabbit Polyclonal Anti-LILRA1 Antibody

See related secondary antibodies

Search for all "LILRA1 / CD85i"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human LILRA1 / CD85i

Product Description for LILRA1 / CD85i

Rabbit anti Human LILRA1 / CD85i.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for LILRA1 / CD85i

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CD85 antigen-like family member I, LIR6, Leukocyte immunoglobulin-like receptor 6, Leukocyte immunoglobulin-like receptor subfamily A member 1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O75019
Immunogen:
The immunogen for anti-LILRA1 antibody is: synthetic peptide directed towards the middle region of Human LILRA1. Synthetic peptide located within the following region: FGSFILCKEGEDEHPQCLNSQPRTHGWSRAIFSVGPVSPSRRWSYRCYAY.
GeneID:
11024
Application WB
Background LILRA1 may act as receptor for class I MHC antigens.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for LILRA1 / CD85i (1 products)

Catalog No. Species Pres. Purity   Source  

LILRA1 / CD85i

LILRA1 / CD85i Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for LILRA1 / CD85i (2 products)

Catalog No. Species Pres. Purity   Source  

LILRA1 Lysate

Western Blot: LILRA1 Lysate [NBL1-12523] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for LILRA1
  Novus Biologicals Inc.

LILRA1 overexpression lysate

LILRA1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn