TA338125 CD300C / CMRF35A1 antibody

Rabbit Polyclonal Anti-CD300C Antibody

See related secondary antibodies

Search for all "CD300C / CMRF35A1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human CD300C / CMRF35A1

Product Description for CD300C / CMRF35A1

Rabbit anti Human CD300C / CMRF35A1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CD300C / CMRF35A1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CD300 antigen-like family member C, CLM-6, CMRF35-A1, CMRF35-like molecule 6
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q08708
Immunogen:
The immunogen for anti-CD300C antibody is: synthetic peptide directed towards the C-terminal region of Human CD300C. Synthetic peptide located within the following region: MGTSGPPTKLPVHTWPSVTRKDSPEPSPHPGSLFSNVRFLLLVLLELPLL.
GeneID:
10871
Application WB
Background The CMRF35 antigen, which was identified by reactivity with a monoclol antibody, is present on monocytes, neutrophils, and some T and B lymphocytes.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CD300C / CMRF35A1 (7 products)

Catalog No. Species Pres. Purity   Source  

CD300C / CMRF35A1

CD300C / CMRF35A1 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
10 µg / €299.00
  OriGene Technologies, Inc.

CD300C / CMRF35A1

CD300C / CMRF35A1 Human > 95 %
Preparation: .
Purity Detail: >95% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
  OriGene Technologies, Inc.

CD300C / CMRF35A1 (21-183, His-tag)

CD300C / CMRF35A1 Human Purified > 85 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

CD300C / CMRF35A1 (21-183, His-tag)

CD300C / CMRF35A1 Human Purified > 85 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

CD300C / CMRF35A1

CD300C / CMRF35A1 Human
  Abnova Taiwan Corp.

CD300C / CMRF35A1

CD300C / CMRF35A1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CD300C / CMRF35A1

CD300C / CMRF35A1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CD300C / CMRF35A1 (2 products)

Catalog No. Species Pres. Purity   Source  

CD300C Lysate

Western Blot: CD300C Lysate [NBL1-08931] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CD300C
  Novus Biologicals Inc.

CD300C overexpression lysate

CD300C overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn