TA338143 ARPC1B / ARC41 antibody

Rabbit Polyclonal Anti-ARPC1B Antibody

See related secondary antibodies

Search for all "ARPC1B / ARC41"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ARPC1B / ARC41

Product Description for ARPC1B / ARC41

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish ARPC1B / ARC41.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ARPC1B / ARC41

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Actin-related protein 2/3 complex subunit 1B, Arp2/3 complex 41 kDa subunit, p41-ARC
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O15143
Immunogen:
The immunogen for anti-ARPC1B antibody is: synthetic peptide directed towards the middle region of Human ARPC1B. Synthetic peptide located within the following region: KKPIRSTVLSLDWHPNNVLLAAGSCDFKCRIFSAYIKEVEERPAPTPWGS.
GeneID:
10095
Application WB
Background This gene encodes one of seven subunits of the human Arp2/3 protein complex. This subunit is a member of the SOP2 family of proteins and is most similar to the protein encoded by gene ARPC1A. The similarity between these two proteins suggests that they both may function as p41 subunit of the human Arp2/3 complex that has been implicated in the control of actin polymerization in cells. It is possible that the p41 subunit is involved in assembling and maintaining the structure of the Arp2/3 complex. Multiple versions of the p41 subunit may adapt the functions of the complex to different cell types or developmental stages. This protein also has a role in centrosomal homeostasis by being an activator and substrate of the Aurora A kise.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ARPC1B / ARC41 (3 products)

Catalog No. Species Pres. Purity   Source  

ARPC1B / ARC41

ARPC1B / ARC41 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ARPC1B / ARC41

ARPC1B / ARC41 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ARPC1B / ARC41

ARPC1B / ARC41 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for ARPC1B / ARC41 (1 products)

Catalog No. Species Pres. Purity   Source  

ARP2-3-subunit-1B Lysate

Western Blot: actin-related protein 2/3 complex subunit 1B Lysate [NBL1-07726] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for ARPC1B Protein
  Novus Biologicals Inc.
  • LinkedIn