TA338155 GPR34 antibody

Rabbit Polyclonal Anti-GPR34 Antibody

See related secondary antibodies

Search for all "GPR34"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat GPR34

Product Description for GPR34

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat GPR34.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GPR34

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms G-protein coupled receptor 34
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UPC5
Immunogen:
The immunogen for anti-GPR34 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR34. Synthetic peptide located within the following region: SFNSCLDPVMYFLMSSNIRKIMCQLLFRRFQGEPSRSESTSEFKPGYSLH.
GeneID:
2857
Application WB
Background G protein-coupled receptors (GPCRs), such as GPR34, are integral membrane proteins containing 7 putative transmembrane domains (TMs). These proteins mediate sigls to the interior of the cell via activation of heterotrimeric G proteins that in turn activate various effector proteins, ultimately resulting in a physiologic response.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GPR34 (3 products)

Catalog No. Species Pres. Purity   Source  

GPR34

GPR34 Human
  Abnova Taiwan Corp.

GPR34

GPR34 Human Purified
  Abnova Taiwan Corp.

GPR34

GPR34 Human Purified
  Abnova Taiwan Corp.
  • LinkedIn