TA338161 GPR6 antibody

Rabbit Polyclonal Anti-GPR6 Antibody

See related secondary antibodies

Search for all "GPR6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat GPR6

Product Description for GPR6

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat GPR6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GPR6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms G-protein coupled receptor 6, Sphingosine 1-phosphate receptor GPR6
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P46095
Immunogen:
The immunogen for anti-GPR6 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR6. Synthetic peptide located within the following region: ATLLPATYNSMINPIIYAFRNQEIQRALWLLLCGCFQSKVPFRSRSPSEV.
GeneID:
2830
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for GPR6 (1 products)

Catalog No. Species Pres. Purity   Source  

GPCR GPR6 Lysate

Western Blot: GPCR GPR6 Lysate [NBL1-11286] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for GPR6.
  Novus Biologicals Inc.
  • LinkedIn