TA338186 FGL1 antibody

Rabbit Polyclonal Anti-FGL1 Antibody

See related secondary antibodies

Search for all "FGL1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish FGL1

Product Description for FGL1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish FGL1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for FGL1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Fibrinogen-like protein 1, HFREP1, HP-041, Hepassocin, Hepatocyte-derived fibrinogen-related protein 1, LFIRE1, Liver fibrinogen-related protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q08830
Immunogen:
The immunogen for anti-FGL1 antibody: synthetic peptide directed towards the middle region of human FGL1. Synthetic peptide located within the following region: EFSVYCDMSDGGGWTVIQRRSDGSENFNRGWKDYENGFGNFVQKHGEYWL.
GeneID:
2267
Application WB
Background Fibrinogen-like 1 is a member of the fibrinogen family. This protein is homologous to the carboxy terminus of the fibrinogen beta- and gamma- subunits which contains the four conserved cysteines of fibrinogens and fibrinogen related proteins. However, this protein lacks the platelet-binding site, cross-linking region and a thrombin-sensitive site which are necessary for fibrin clot formation. This protein may play a role in the development of hepatocellular carcinomas. Four altertively spliced transcript variants encoding the same protein exist for this gene. [provided by RefSeq, Jul 2008].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for FGL1 (4 products)

Catalog No. Species Pres. Purity   Source  

FGL1 (transcript variant 4)

FGL1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FGL1 (transcript variant 1)

FGL1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

FGL1

FGL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

FGL1

FGL1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for FGL1 (9 products)

Catalog No. Species Pres. Purity   Source  

FGL1 293T Cell Transient Overexpression Lysate(Denatured)

FGL1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

FGL1 Lysate

Western Blot: FGL1 Lysate [NBL1-10710] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for FGL1
  Novus Biologicals Inc.

FGL1 overexpression lysate

FGL1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

FGL1 overexpression lysate

FGL1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

FGL1 overexpression lysate

FGL1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

FGL1 overexpression lysate

FGL1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

FGL1 overexpression lysate

FGL1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

FGL1 overexpression lysate

FGL1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.

FGL1 overexpression lysate

FGL1 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn