TA338188 Catenin alpha-2 / CTNNA2 antibody

Rabbit Polyclonal Anti-CTNNA2 Antibody

See related secondary antibodies

Search for all "Catenin alpha-2 / CTNNA2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Catenin alpha-2 / CTNNA2

Product Description for Catenin alpha-2 / CTNNA2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Catenin alpha-2 / CTNNA2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Catenin alpha-2 / CTNNA2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Alpha Catenin 2, Alpha N-catenin, Alpha-catenin-related protein, CAPR
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P26232
Immunogen:
The immunogen for anti-CTNNA2 antibody is: synthetic peptide directed towards the C-terminal region of Human CTNNA2. Synthetic peptide located within the following region: YQKVYGTAAVNSPVVSWKMKAPEKKPLVKREKPEEFQTRVRRGSQKKHIS.
GeneID:
1496
Application WB
Background CTN2 may function as a linker between cadherin adhesion receptors and the cytoskeleton to regulate cell-cell adhesion and differentiation in the nervous system. Regulates morphological plasticity of sypses and cerebellar and hippocampal lamition during development. It functions in the control of startle modulation.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Catenin alpha-2 / CTNNA2 (3 products)

Catalog No. Species Pres. Purity   Source  

Catenin alpha-2 / CTNNA2

Catenin alpha-2 / CTNNA2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

Catenin alpha-2 / CTNNA2

Catenin alpha-2 / CTNNA2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Catenin alpha-2 / CTNNA2

Catenin alpha-2 / CTNNA2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Catenin alpha-2 / CTNNA2 (2 products)

Catalog No. Species Pres. Purity   Source  

alpha 2 Catenin Lysate

Western Blot: Catenin Alpha 2 Lysate [NBL1-09576] - 
Left-Control; Right -Over-expression Lysate for CTNNA2
  Novus Biologicals Inc.

CTNNA2 293T Cell Transient Overexpression Lysate(Denatured)

CTNNA2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn