TA338234 DNAJC7 / TPR2 antibody

Rabbit Polyclonal Anti-DNAJC7 Antibody

See related secondary antibodies

Search for all "DNAJC7 / TPR2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish DNAJC7 / TPR2

Product Description for DNAJC7 / TPR2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish DNAJC7 / TPR2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for DNAJC7 / TPR2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms DnaJ homolog subfamily C member 7, TPR repeat protein 2, TTC2, Tetratricopeptide repeat protein 2
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q99615
Immunogen:
The immunogen for anti-DNAJC7 antibody is: synthetic peptide directed towards the C-terminal region of Human DNAJC7. Synthetic peptide located within the following region: KTKEHKQLLKNAQLELKKSKRKDYYKILGVDKNASEDEIKKAYRKRALMH.
GeneID:
7266
Application WB
Background This gene encodes a member of the DJ heat shock protein 40 family of proteins that is characterized by two N-termil tetratricopeptide repeat domains and a C-termil DJ domain. This protein binds the chaperone proteins heat shock proteins 70 and 90 in an ATP-dependent manner and may function as a co-chaperone. Pseudogenes of this gene are found on chromosomes 1 and 6. Alterte splicing results in multiple transcript variants.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for DNAJC7 / TPR2 (3 products)

Catalog No. Species Pres. Purity   Source  

DNAJC7 / TPR2 (transcript variant 1)

DNAJC7 / TPR2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

DNAJC7 / TPR2

DNAJC7 / TPR2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

DNAJC7 / TPR2

DNAJC7 / TPR2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for DNAJC7 / TPR2 (1 products)

Catalog No. Species Pres. Purity   Source  

DNAJC7 Lysate

Western Blot: DNAJC7 Lysate [NBL1-09956] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for DNAJC7
  Novus Biologicals Inc.
  • LinkedIn