TA338251 ROR-alpha / RORA antibody

Rabbit Polyclonal Anti-RORA Antibody

See related secondary antibodies

Search for all "ROR-alpha / RORA"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat ROR-alpha / RORA

Product Description for ROR-alpha / RORA

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat ROR-alpha / RORA.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ROR-alpha / RORA

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms NR1F1, Nuclear receptor ROR-alpha, Nuclear receptor RZR-alpha, Nuclear receptor subfamily 1 group F member 1, RZRA, Retinoid-related orphan receptor-alpha
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P35398
Immunogen:
The immunogen for anti-RORA antibody: synthetic peptide directed towards the middle region of human RORA. Synthetic peptide located within the following region: PGEAEPLTPTYNISANGLTELHDDLSNYIDGHTPEGSKADSAVSSFYLDI.
GeneID:
6095
Application WB
Background The protein encoded by this gene is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The encoded protein has been shown to interact with NM23-2, a nucleoside diphosphate kise involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene. Also, it has been shown to aid in the transcriptiol regulation of some genes involved in circadian rhythm. Four transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Feb 2014].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ROR-alpha / RORA (6 products)

Catalog No. Species Pres. Purity   Source  

ROR-alpha / RORA (transcript variant 1)

ROR-alpha / RORA Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

ROR-alpha / RORA

ROR-alpha / RORA Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ROR-alpha / RORA

ROR-alpha / RORA Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ROR-alpha / RORA

ROR-alpha / RORA Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

ROR-alpha / RORA

ROR-alpha / RORA Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ROR-alpha / RORA

ROR-alpha / RORA Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ROR-alpha / RORA (3 products)

Catalog No. Species Pres. Purity   Source  

ROR alpha Lysate

Western Blot: ROR alpha Lysate [NBL1-15479] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RORA
  Novus Biologicals Inc.

ROR alpha Lysate

Western Blot: ROR alpha Lysate [NBL1-15480] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RORA
  Novus Biologicals Inc.

RORA overexpression lysate

RORA overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn