TA338252 PPP1CB antibody

Rabbit Polyclonal Anti-PPP1CB Antibody

See related secondary antibodies

Search for all "PPP1CB"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish PPP1CB

Product Description for PPP1CB

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Yeast, Zebrafish PPP1CB.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for PPP1CB

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms PP-1B, PP1beta, PPP1CD, Protein phosphatase 1-beta, Protein phosphatase 1-delta, Serine/threonine-protein phosphatase PP1-beta catalytic subunit
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ye, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P62140
Immunogen:
The immunogen for anti-PPP1CB antibody is: synthetic peptide directed towards the C-terminal region of Human PPP1CB. Synthetic peptide located within the following region: LFSAPNYCGEFDNAGGMMSVDETLMCSFQILKPSEKKAKYQYGGLNSGRP.
GeneID:
5500
Application WB
Background The protein encoded by this gene is one of the three catalytic subunits of protein phosphatase 1 (PP1). PP1 is a serine/threonine specific protein phosphatase known to be involved in the regulation of a variety of cellular processes, such as cell division, glycogen metabolism, muscle contractility, protein synthesis, and HIV-1 viral transcription. Mouse studies suggest that PP1 functions as a suppressor of learning and memory. Two altertively spliced transcript variants encoding distinct isoforms have been observed.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for PPP1CB (4 products)

Catalog No. Species Pres. Purity   Source  

PPP1CB (transcript variant 3)

PPP1CB Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

PPP1CB

PPP1CB Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PPP1CB

PPP1CB Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

PPP1CB

PPP1CB Human
  Abnova Taiwan Corp.

Positive controls for PPP1CB (3 products)

Catalog No. Species Pres. Purity   Source  

PPP1CB 293T Cell Transient Overexpression Lysate(Denatured)

PPP1CB 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

Protein Phosphatase 1 beta Lysate

Western Blot: Protein Phosphatase 1 beta Lysate [NBL1-14671] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PPP1CB
  Novus Biologicals Inc.

Protein Phosphatase 1 beta Lysate

Western Blot: Protein Phosphatase 1 beta Lysate [NBL1-14672] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for PPP1CB
  Novus Biologicals Inc.
  • LinkedIn