TA338254 NTH1 antibody

Rabbit Polyclonal Anti-NTHL1 Antibody

See related secondary antibodies

Search for all "NTH1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat NTH1

Product Description for NTH1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rat NTH1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NTH1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Endonuclease III-like protein 1, NTHL1, OCTS3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P78549
Immunogen:
The immunogen for anti-NTHL1 antibody is: synthetic peptide directed towards the N-terminal region of Human NTHL1. Synthetic peptide located within the following region: DWQQQLVNIRAMRNKKDAPVDHLGTEHCYDSSAPPKVRRYQVLLSLMLSS.
GeneID:
4913
Application WB
Background The protein encoded by this gene is a D N-glycosylase of the endonuclease III family. Like a similar protein in E. coli, the encoded protein has D glycosylase activity on D substrates containing oxidized pyrimidine residues and has apurinic/apyrimidinic lyase activity.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NTH1 (6 products)

Catalog No. Species Pres. Purity   Source  

NTH1

NTH1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

NTH1 (full length, N-term HIS tag)

NTH1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

NTH1 (1-312, His-tag)

NTH1 Human Purified > 80 % by SDS - PAGE E. coli
0.25 mg / €1,070.00
  OriGene Technologies GmbH

NTH1 (1-312, His-tag)

NTH1 Human Purified > 80 % by SDS - PAGE E. coli
50 µg / €400.00
  OriGene Technologies GmbH

NTH1

NTH1 Human Purified
  Abnova Taiwan Corp.

NTH1

NTH1 Human Purified
  Abnova Taiwan Corp.
  • LinkedIn