TA338270 Motilin receptor antibody

Rabbit Polyclonal Anti-MLNR Antibody

See related secondary antibodies

Search for all "Motilin receptor"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human Motilin receptor

Product Description for Motilin receptor

Rabbit anti Human Motilin receptor.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Motilin receptor

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms G-protein coupled receptor 38, GPR38, MLNR, MTLR, MTLR1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O43193
Immunogen:
The immunogen for anti-MLNR antibody is: synthetic peptide directed towards the C-terminal region of Human MLNR. Synthetic peptide located within the following region: ASINPILYNLISKKYRAAAFKLLLARKSRPRGFHRSRDTAGEVAGDTGGD.
GeneID:
2862
Application WB
Background Motilin is a 22 amino acid peptide hormone expressed throughout the gastrointestil (GI) tract. The protein encoded by this gene is a motilin receptor which is a member of the G-protein coupled receptor 1 family. This member is a multi-pass transmembrane protein, and is an important therapeutic target for the treatment of hypomotility disorders.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for Motilin receptor (1 products)

Catalog No. Species Pres. Purity   Source  

MLNR overexpression lysate

MLNR overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn