TA338287 GPR35 antibody

Rabbit Polyclonal Anti-GPR35 Antibody

See related secondary antibodies

Search for all "GPR35"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Mouse, Rat GPR35

Product Description for GPR35

Rabbit anti Human, Mouse, Rat GPR35.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GPR35

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms G-protein coupled receptor 35, KYNA receptor, Kynurenic acid receptor
Presentation Purified
Reactivity Hu, Ms, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9HC97
Immunogen:
The immunogen for anti-GPR35 antibody is: synthetic peptide directed towards the C-terminal region of Human GPR35. Synthetic peptide located within the following region: HNFNSMAFPLLGFYLPLAVVVFCSLKVVTALAQRPPTDVGQAEATRKAAR.
GeneID:
2859
Application WB
Background GPR35 acts as a receptor for kynurenic acid, an intermediate in the tryptophan metabolic pathway. The activity of this receptor is mediated by G-proteins that elicit calcium mobilization and inositol phosphate production through G(qi/o) proteins.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn