TA338301 Delphilin antibody

Rabbit Polyclonal Anti-GRID2IP Antibody

See related secondary antibodies

Search for all "Delphilin"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Delphilin

Product Description for Delphilin

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat Delphilin.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Delphilin

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms GRID2IP, Glutamate receptor, delta 2-interacting protein 1, ionotropic
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
A4D2P6
Immunogen:
The immunogen for anti-GRID2IP antibody is: synthetic peptide directed towards the middle region of Human GRID2IP. Synthetic peptide located within the following region: CFLGYTAMTAEPEPELDLESEPTPEPQPRSSLRASSMCRRSLRSQGLEAG.
GeneID:
392862
Application WB
Background Glutamate receptor delta-2 is predomintly expressed at parallel fiber-Purkinje cell postsypses and plays crucial roles in syptogenesis and syptic plasticity. GRID2IP1 interacts with GRID2 and may control GRID2 sigling in Purkinje cells.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Delphilin (1 products)

Catalog No. Species Pres. Purity   Source  

Delphilin

Delphilin Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €788.00
  OriGene Technologies, Inc.

Positive controls for Delphilin (1 products)

Catalog No. Species Pres. Purity   Source  

GRID2IP overexpression lysate

GRID2IP overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn