TA338305 RPL28 antibody

Rabbit Polyclonal Anti-RPL28 Antibody

See related secondary antibodies

Search for all "RPL28"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish RPL28

Product Description for RPL28

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish RPL28.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RPL28

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 60S ribosomal protein L28
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P46779
Immunogen:
The immunogen for anti-RPL28 antibody is: synthetic peptide directed towards the N-terminal region of Human RPL28. Synthetic peptide located within the following region: SSFLIKRNKQTYSTEPNNLKARNSFRYNGLIHRKTVGVEPAADGKGVVVV.
GeneID:
6158
Application WB
Background Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 R species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L28E family of ribosomal proteins. It is located in the cytoplasm. Variable expression of this gene in colorectal cancers compared to adjacent normal tissues has been observed, although no correlation between the level of expression and the severity of the disease has been found. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RPL28 (4 products)

Catalog No. Species Pres. Purity   Source  

RPL28

RPL28 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RPL28

RPL28 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

RPL28

RPL28 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

RPL28

RPL28 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for RPL28 (1 products)

Catalog No. Species Pres. Purity   Source  

RPL28 Lysate

Western Blot: RPL28 Lysate [NBL1-15521] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RPL28
  Novus Biologicals Inc.
  • LinkedIn