TA338317 CABLES1 antibody

Rabbit Polyclonal Anti-CABLES1 Antibody

See related secondary antibodies

Search for all "CABLES1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CABLES1

Product Description for CABLES1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat CABLES1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CABLES1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CDK5 and ABL1 enzyme substrate 1, Ik3-1, Interactor with CDK3 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q8TDN4
Immunogen:
The immunogen for anti-CABLES1 antibody is: synthetic peptide directed towards the C-terminal region of Human CABLES1. Synthetic peptide located within the following region: IRSLKREMRKLAQEDCGLEEPTVAMAFVYFEKLALKGKLNKQNRKLCAGA.
GeneID:
91768
Application WB
Background This gene encodes a protein involved in regulation of the cell cycle through interactions with several cyclin-dependent kises. One study reported aberrant splicing of transcripts from this gene which results in removal of the cyclin binding domain only in human cancer cells, and reduction in gene expression was shown in colorectal cancers.Multiple transcript variants encoding different isoforms have been found for this gene.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CABLES1 (3 products)

Catalog No. Species Pres. Purity   Source  

CABLES1 (full length, N-term HIS tag, transcript variant 1)

CABLES1 Human > 80 %
Preparation: .
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
E. coli
50 µg / €205.00
  OriGene Technologies, Inc.

CABLES1

CABLES1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CABLES1

CABLES1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for CABLES1 (1 products)

Catalog No. Species Pres. Purity   Source  

CABLES1 293T Cell Transient Overexpression Lysate(Denatured)

CABLES1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn