TA338319 T-FABP / FABP9 antibody

Rabbit Polyclonal Anti-FABP9 Antibody

See related secondary antibodies

Search for all "T-FABP / FABP9"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish T-FABP / FABP9

Product Description for T-FABP / FABP9

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Goat, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish T-FABP / FABP9.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for T-FABP / FABP9

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Fatty acid-binding protein 9, TLBP, Testis lipid-binding protein, Testis-type fatty acid-binding protein
Presentation Purified
Reactivity Bov, Can, Eq, GP, Gt, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q0Z7S8
Immunogen:
The immunogen for anti-FABP9 antibody is: synthetic peptide directed towards the middle region of Human FABP9. Synthetic peptide located within the following region: SFKLGEEFDETTADNRKVKSTITLENGSMIHVQKWLGKETTIKRKIVDEK.
GeneID:
646480
Application WB
Background The function of this protein remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for T-FABP / FABP9 (4 products)

Catalog No. Species Pres. Purity   Source  

T-FABP / FABP9

T-FABP / FABP9 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

T-FABP / FABP9 (1-132, His-tag)

T-FABP / FABP9 Human Purified > 95 % by SDS - PAGE E. coli
0.5 mg / €820.00
  OriGene Technologies GmbH

T-FABP / FABP9 (1-132, His-tag)

T-FABP / FABP9 Human Purified > 95 % by SDS - PAGE E. coli
0.1 mg / €320.00
  OriGene Technologies GmbH

T-FABP / FABP9

T-FABP / FABP9 Human
  Abnova Taiwan Corp.

Positive controls for T-FABP / FABP9 (1 products)

Catalog No. Species Pres. Purity   Source  

FABP9 overexpression lysate

FABP9 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn