TA338347 CACNB4 antibody

Rabbit Polyclonal Anti-CACNB4 Antibody

See related secondary antibodies

Search for all "CACNB4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish CACNB4

Product Description for CACNB4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish CACNB4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CACNB4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CAB4, CACNLB4, Calcium channel voltage-dependent subunit beta 4, Voltage-dependent L-type calcium channel subunit beta-4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O00305
Immunogen:
The immunogen for anti-CACNB4 antibody: synthetic peptide directed towards the C terminal of human CACNB4. Synthetic peptide located within the following region: LEAYWRATHTTSSTPMTPLLGRNLGSTALSPYPTAISGLQSQRMRHSNHS.
GeneID:
785
Application WB
Background This gene encodes a member of the beta subunit family of voltage-dependent calcium channel complex proteins. Calcium channels mediate the influx of calcium ions into the cell upon membrane polarization and consist of a complex of alpha-1, alpha-2/delta, beta, and gamma subunits in a 1:1:1:1 ratio. Various versions of each of these subunits exist, either expressed from similar genes or the result of altertive splicing. The protein encoded by this locus plays an important role in calcium channel function by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and ictivation. Certain mutations in this gene have been associated with idiopathic generalized epilepsy (IGE) and juvenile myoclonic epilepsy (JME). Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Mar 2009].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CACNB4 (5 products)

Catalog No. Species Pres. Purity   Source  

CACNB4 (transcript variant 2)

CACNB4 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CACNB4

CACNB4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CACNB4

CACNB4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CACNB4

CACNB4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CACNB4

CACNB4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for CACNB4 (6 products)

Catalog No. Species Pres. Purity   Source  

CACNB4 293T Cell Transient Overexpression Lysate(Denatured)

CACNB4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CACNB4 Lysate

Western Blot: CACNB4 Lysate [NBL1-08630] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CACNB4
  Novus Biologicals Inc.

CACNB4 overexpression lysate

CACNB4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.

CACNB4 overexpression lysate

CACNB4 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

CACNB4 overexpression lysate

CACNB4 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

CACNB4 overexpression lysate

CACNB4 overexpression lysate
0.1 mg / €315.00
  OriGene Technologies, Inc.
  • LinkedIn