TA338360 GART antibody

Rabbit Polyclonal Anti-GART Antibody

See related secondary antibodies

Search for all "GART"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Equine, Human GART

Product Description for GART

Rabbit anti Equine, Human GART.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for GART

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AIR synthase, AIRS, GAR transformylase, GARS, Glycinamide ribonucleotide synthetase, PGFT, PRGS, Trifunctional purine biosynthetic protein adenosine-3
Presentation Purified
Reactivity Eq, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P22102
Immunogen:
The immunogen for anti-GART antibody: synthetic peptide directed towards the middle region of human GART. Synthetic peptide located within the following region: VLKNGSLTNHFSFEKKKARVAVLISGTGSNLQALIDSTREPNSSAQIDIV.
GeneID:
2618
Application WB
Background The protein encoded by this gene is a trifunctiol polypeptide. It has phosphoribosylglycimide formyltransferase, phosphoribosylglycimide synthetase, phosphoribosylaminoimidazole synthetase activity which is required for de novo purine biosynthesis. This enzyme is highly conserved in vertebrates. Altertive splicing of this gene results in two transcript variants encoding different isoforms. [provided by RefSeq, Jul 2008].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for GART (3 products)

Catalog No. Species Pres. Purity   Source  

GART (transcript variant 2)

GART Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

GART

GART Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

GART

GART Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for GART (3 products)

Catalog No. Species Pres. Purity   Source  

GART 293T Cell Transient Overexpression Lysate(Denatured)

GART 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

GART HEK293 Cell Transient Overexpression Lysate (Non-Denatured)

GART HEK293 Cell Transient Overexpression Lysate (Non-Denatured) Transient overexpression cell lysate was tested with Anti-GART antibody (H00002618-M01) by Western Blots.
  Abnova Taiwan Corp.

GART overexpression lysate

GART overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn