TA338363 Neuronal acetylcholine receptor subunit alpha-5 antibody

Rabbit Polyclonal Anti-CHRNA5 Antibody

See related secondary antibodies

Search for all "Neuronal acetylcholine receptor subunit alpha-5"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Neuronal acetylcholine receptor subunit alpha-5

Product Description for Neuronal acetylcholine receptor subunit alpha-5

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Neuronal acetylcholine receptor subunit alpha-5.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Neuronal acetylcholine receptor subunit alpha-5

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CHRNA5, NACHRA5, Nicotinic acetylcholine receptor subunit alpha-5
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P30532
Immunogen:
The immunogen for anti-CHRNA5 antibody: synthetic peptide directed towards the middle region of human CHRNA5. Synthetic peptide located within the following region: DGSQVDIILEDQDVDKRDFFDNGEWEIVSATGSKGNRTDSCCWYPYVTYS.
GeneID:
1138
Application WB
Background The protein encoded by this gene is a nicotinic acetylcholine receptor subunit and a member of a superfamily of ligand-gated ion channels that mediate fast sigl transmission at sypses. These receptors are thought to be heteropentamers composed of separate but similar subunits. Defects in this gene have been linked to susceptibility to lung cancer type 2 (LNCR2).[provided by RefSeq, Jun 2010].
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Neuronal acetylcholine receptor subunit alpha-5 (2 products)

Catalog No. Species Pres. Purity   Source  

Neuronal acetylcholine receptor subunit alpha-5

Neuronal acetylcholine receptor subunit alpha-5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Neuronal acetylcholine receptor subunit alpha-5

Neuronal acetylcholine receptor subunit alpha-5 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.
  • LinkedIn