TA338364 Neuronal acetylcholine receptor subunit alpha-4 antibody

Rabbit Polyclonal Anti-CHRNA4 Antibody

See related secondary antibodies

Search for all "Neuronal acetylcholine receptor subunit alpha-4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Neuronal acetylcholine receptor subunit alpha-4

Product Description for Neuronal acetylcholine receptor subunit alpha-4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish Neuronal acetylcholine receptor subunit alpha-4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Neuronal acetylcholine receptor subunit alpha-4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CHRNA4, NACRA4, Nicotinic acetylcholine receptor subunit alpha 4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P43681
Immunogen:
The immunogen for anti-CHRNA4 antibody: synthetic peptide directed towards the N terminal of human CHRNA4. Synthetic peptide located within the following region: AEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTT.
GeneID:
1137
Application WB
Background This gene encodes a nicotinic acetylcholine receptor, which belongs to a superfamily of ligand-gated ion channels that play a role in fast sigl transmission at sypses. These pentameric receptors can bind acetylcholine, which causes an extensive change in conformation that leads to the opening of an ion-conducting channel across the plasma membrane. This protein is an integral membrane receptor subunit that can interact with either ChR beta-2 or ChR beta-4 to form a functiol receptor. Mutations in this gene cause nocturl frontal lobe epilepsy type 1. Polymorphisms in this gene that provide protection against nicotine addiction have been described. Altertive splicing results in multiple transcript variants. [provided by RefSeq, Feb 2012].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Neuronal acetylcholine receptor subunit alpha-4 (2 products)

Catalog No. Species Pres. Purity   Source  

Neuronal acetylcholine receptor subunit alpha-4

Neuronal acetylcholine receptor subunit alpha-4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Neuronal acetylcholine receptor subunit alpha-4

Neuronal acetylcholine receptor subunit alpha-4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Neuronal acetylcholine receptor subunit alpha-4 (2 products)

Catalog No. Species Pres. Purity   Source  

CHRNA4 293T Cell Transient Overexpression Lysate(Denatured)

CHRNA4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

Nicotinic Acetylcholine Receptor alpha 4 Lysate

Western Blot: Nicotinic Acetylcholine Receptor alpha 4 Lysate [NBL1-09181] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CHRNA4
  Novus Biologicals Inc.
  • LinkedIn