TA338372 CACNB1 antibody

Rabbit Polyclonal Anti-CACNB1 Antibody

See related secondary antibodies

Search for all "CACNB1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish CACNB1

Product Description for CACNB1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish CACNB1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CACNB1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CAB1, CACNLB1, Calcium channel voltage-dependent subunit beta 1, Voltage-dependent L-type calcium channel subunit beta-1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q02641
Immunogen:
The immunogen for anti-CACNB1 antibody: synthetic peptide directed towards the N terminal of human CACNB1. Synthetic peptide located within the following region: DWWIGRLVKEGCEVGFIPSPVKLDSLRLLQEQKLRQNRLGSSKSGDNSSS.
GeneID:
782
Application WB
Background The protein encoded by this gene belongs to the calcium channel beta subunit family. It plays an important role in the calcium channel by modulating G protein inhibition, increasing peak calcium current, controlling the alpha-1 subunit membrane targeting and shifting the voltage dependence of activation and ictivation. Altertive splicing occurs at this locus and three transcript variants encoding three distinct isoforms have been identified. [provided by RefSeq, Jul 2008].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for CACNB1 (6 products)

Catalog No. Species Pres. Purity   Source  

CACNB1 (transcript variant 1)

CACNB1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CACNB1 (transcript variant 2)

CACNB1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

CACNB1

CACNB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CACNB1

CACNB1 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

CACNB1

CACNB1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

CACNB1

CACNB1 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for CACNB1 (5 products)

Catalog No. Species Pres. Purity   Source  

CACNB1 293T Cell Transient Overexpression Lysate(Denatured)

CACNB1 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

CACNB1 Lysate

Western Blot: CACNB1 Lysate [NBL1-08628] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for CACNB1
  Novus Biologicals Inc.

CACNB1 overexpression lysate

CACNB1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

CACNB1 overexpression lysate

CACNB1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.

CACNB1 overexpression lysate

CACNB1 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn