TA338393 Acetylcholine receptor alpha subunit antibody

Rabbit Polyclonal Anti-CHRNA1 Antibody

See related secondary antibodies

Search for all "Acetylcholine receptor alpha subunit"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Acetylcholine receptor alpha subunit

Product Description for Acetylcholine receptor alpha subunit

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Acetylcholine receptor alpha subunit.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Acetylcholine receptor alpha subunit

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ACHRA, CHNRA, CHRNA1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P02708
Immunogen:
The immunogen for anti-CHRNA1 antibody: synthetic peptide directed towards the N terminal of human CHRNA1. Synthetic peptide located within the following region: AGLVLGSEHETRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVD.
GeneID:
1134
Application WB
Background The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha subunits and 1 each of the beta, gamma, and delta subunits. This gene encodes an alpha subunit that plays a role in acetlycholine binding/channel gating. Altertively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Nov 2012].
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Acetylcholine receptor alpha subunit (2 products)

Catalog No. Species Pres. Purity   Source  

Acetylcholine receptor alpha subunit

Acetylcholine receptor alpha subunit Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Acetylcholine receptor alpha subunit

Acetylcholine receptor alpha subunit Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.
  • LinkedIn