TA338401 UGCGL1 / RUGT antibody

Rabbit Polyclonal Anti-UGGT1 Antibody

See related secondary antibodies

Search for all "UGCGL1 / RUGT"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human, Porcine UGCGL1 / RUGT

Product Description for UGCGL1 / RUGT

Rabbit anti Human, Porcine UGCGL1 / RUGT.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for UGCGL1 / RUGT

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Gt, UDP-Glc:glycoprotein glucosyltransferase, UDP-glucose ceramide glucosyltransferase-like 1, UDP-glucose:glycoprotein glucosyltransferase 1, Uggt, Ugt1, Ugtr
Presentation Purified
Reactivity Hu, Por
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NYU2
Immunogen:
The immunogen for anti-UGGT1 antibody: synthetic peptide directed towards the middle region of human UGGT1. Synthetic peptide located within the following region: AAVRIVPEWQDYDQEIKQLQIRFQKEKETGALYKEKTKEPSREGPQKREE.
GeneID:
56886
Application WB
Background UDP-glucose:glycoprotein glucosyltransferase (UGT) is a soluble protein of the endoplasmic reticulum (ER) that selectively reglucosylates unfolded glycoproteins, thus providing quality control for protein transport out of the ER.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for UGCGL1 / RUGT (1 products)

Catalog No. Species Pres. Purity   Source  

UGGT1 overexpression lysate

UGGT1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn