TA338403 C15orf24 antibody

Rabbit Polyclonal Anti-EMC7 Antibody

See related secondary antibodies

Search for all "C15orf24"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat C15orf24

Product Description for C15orf24

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat C15orf24.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for C15orf24

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C11orf3, UPF0480 protein C15orf24
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NPA0
Immunogen:
The immunogen for anti-EMC7antibody: synthetic peptide directed towards the middle region of human C15orf24. Synthetic peptide located within the following region: VDITSKGKMRARYVNYIKTSEVVRLPYPLQMKSSGPPSYFIKRESWGWTD.
GeneID:
56851
Application WB
Background The exact function of EMC7remains unknown.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for C15orf24 (3 products)

Catalog No. Species Pres. Purity   Source  

C15orf24

C15orf24 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

C15orf24

C15orf24 Human Purified
  Abnova Taiwan Corp.

C15orf24

C15orf24 Human Purified
  Abnova Taiwan Corp.

Positive controls for C15orf24 (3 products)

Catalog No. Species Pres. Purity   Source  

C15orf24 293T Cell Transient Overexpression Lysate(Denatured)

C15orf24 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

C15orf24 Lysate

Western Blot: C15orf24 Lysate [NBL1-08201] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for C15orf24 Protein
  Novus Biologicals Inc.

EMC7 overexpression lysate

EMC7 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn