TA338406 Cyclin M4 antibody

Rabbit Polyclonal Anti-CNNM4 Antibody

See related secondary antibodies

Search for all "Cyclin M4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Cyclin M4

Product Description for Cyclin M4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Cyclin M4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Cyclin M4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms ACDP4, Ancient conserved domain-containing protein 4. CNNM4, KIAA1592, Metal transporter CNNM4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q6P4Q7
Immunogen:
The immunogen for anti-CNNM4 antibody: synthetic peptide directed towards the middle region of human CNNM4. Synthetic peptide located within the following region: LLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKA.
GeneID:
26504
Application WB
Background CNNM4 belongs to the ACDP family.It is a metal transporter. The interaction with the metal ion chaperone COX11 suggests that CNNM4 may play a role in sensory neuron functions.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Cyclin M4 (2 products)

Catalog No. Species Pres. Purity   Source  

Cyclin M4

Cyclin M4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Cyclin M4

Cyclin M4 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for Cyclin M4 (1 products)

Catalog No. Species Pres. Purity   Source  

CNNM4 overexpression lysate

CNNM4 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn