TA338413 ENTPD7 / LALP1 antibody

Rabbit Polyclonal Anti-ENTPD7 Antibody

See related secondary antibodies

Search for all "ENTPD7 / LALP1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ENTPD7 / LALP1

Product Description for ENTPD7 / LALP1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat ENTPD7 / LALP1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ENTPD7 / LALP1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Ectonucleoside triphosphate diphosphohydrolase 7, Lysosomal apyrase-like protein 1, NTPDase 7
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9NQZ7
Immunogen:
The immunogen for anti-ENTPD7 antibody: synthetic peptide directed towards the C terminal of human ENTPD7. Synthetic peptide located within the following region: EHRLKYQCFKSAWMYQVLHEGFHFPYDYPNLRTAQLVYDREVQWTLGAIL.
GeneID:
57089
Application WB
Background ENTPD7 is a multi-pass membrane protein.It belongs to the GDA1/CD39 NTPase family. It preferentially hydrolyzes nucleoside 5'-triphosphates. The order of activity with respect to possible substrates is UTP > GTP > CTP.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ENTPD7 / LALP1 (1 products)

Catalog No. Species Pres. Purity   Source  

ENTPD7 / LALP1

ENTPD7 / LALP1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for ENTPD7 / LALP1 (1 products)

Catalog No. Species Pres. Purity   Source  

ENTPD7 overexpression lysate

ENTPD7 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn