TA338474 ADAM30 antibody

Rabbit Polyclonal Anti-ADAM30 Antibody

See related secondary antibodies

Search for all "ADAM30"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Human ADAM30

Product Description for ADAM30

Rabbit anti Bovine, Canine, Human ADAM30.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for ADAM30

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Disintegrin and metalloproteinase domain-containing protein 30
Presentation Purified
Reactivity Bov, Can, Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9UKF2
Immunogen:
The immunogen for anti-ADAM30 antibody: synthetic peptide directed towards the N terminal of human ADAM30. Synthetic peptide located within the following region: RLLLPRHLRVFSFTEHGELLEDHPYIPKDCNYMGSVKESLDSKATISTCM.
GeneID:
11085
Application WB
Background ADAM30 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to ske venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. ADAM30 gene is testis-specific and contains a polymorphic region, resulting in isoforms with varying numbers of C-termil repeats.This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to ske venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This gene is testis-specific and contains a polymorphic region, resulting in isoforms with varying numbers of C-termil repeats.
Format
Purification:
Protein A purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for ADAM30 (2 products)

Catalog No. Species Pres. Purity   Source  

ADAM30

ADAM30 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

ADAM30

ADAM30 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for ADAM30 (1 products)

Catalog No. Species Pres. Purity   Source  

ADAM30 Lysate

Western Blot: ADAM30 Lysate [NBL1-07311] - Western Blot experiments.  Left-Control; Right -Over-expression Lysate for ADAM30. Protein
  Novus Biologicals Inc.
  • LinkedIn