TA338486 Tenomodulin (TNMD) antibody

Rabbit Polyclonal Anti-TNMD Antibody

See related secondary antibodies

Search for all "Tenomodulin (TNMD)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish Tenomodulin (TNMD)

Product Description for Tenomodulin (TNMD)

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Sheep, Zebrafish Tenomodulin (TNMD).
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Tenomodulin (TNMD)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CHM1L, Chondromodulin-1-like protein, Chondromodulin-I-like protein, Myodulin, Tendin
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Sh, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H2S6
Immunogen:
The immunogen for anti-TNMD antibody: synthetic peptide directed towards the N terminal of human TNMD. Synthetic peptide located within the following region: KKKIYMEIDPVTRTEIFRSGNGTDETLEVHDFKNGYTGIYFVGLQKCFIK.
GeneID:
64102
Application WB
Background TNMD is a single-pass type II membrane proteinPotential. It belongs to the chondromodulin-1 family and contains 1 BRICHOS domain. TNMD may be an angiogenesis inhibitor.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Tenomodulin (TNMD) (1 products)

Catalog No. Species Pres. Purity   Source  

Tenomodulin (TNMD)

Tenomodulin (TNMD) Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for Tenomodulin (TNMD) (1 products)

Catalog No. Species Pres. Purity   Source  

TNMD overexpression lysate

TNMD overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn