TA338489 Xylosyltransferase 1 antibody

Rabbit Polyclonal Anti-XYLT1 Antibody

See related secondary antibodies

Search for all "Xylosyltransferase 1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Xylosyltransferase 1

Product Description for Xylosyltransferase 1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Xylosyltransferase 1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Xylosyltransferase 1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Peptide O-xylosyltransferase 1, XT-I, XT1, XYLT1, XylT-I, Xylosyltransferase I
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86Y38
Immunogen:
The immunogen for anti-XYLT1 antibody: synthetic peptide directed towards the middle region of human XYLT1. Synthetic peptide located within the following region: RITNWNRKLGCKCQYKHIVDWCGCSPNDFKPQDFHRFQQTARPTFFARKF.
GeneID:
64131
Application WB
Background This locus encodes a xylosyltransferase enzyme. The encoded protein catalyzes transfer of UDP-xylose to serine residues of an acceptor protein substrate. This transfer reaction is necessary for biosynthesis of glycosaminoglycan chains. Mutations in this gene have been associated with increased severity of pseudoxanthoma elasticum.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for Xylosyltransferase 1 (1 products)

Catalog No. Species Pres. Purity   Source  

XYLT1 overexpression lysate

XYLT1 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn