TA338491 Xylosyltransferase 2 / XYLT2 antibody

Rabbit Polyclonal Anti-XYLT2 Antibody

See related secondary antibodies

Search for all "Xylosyltransferase 2 / XYLT2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Xylosyltransferase 2 / XYLT2

Product Description for Xylosyltransferase 2 / XYLT2

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Xylosyltransferase 2 / XYLT2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Xylosyltransferase 2 / XYLT2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Peptide O-xylosyltransferase 1, XT-II, XT2, XylT-II, Xylosyltransferase II
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H1B5
Immunogen:
The immunogen for anti-XYLT2 antibody: synthetic peptide directed towards the C terminal of human XYLT2. Synthetic peptide located within the following region: LRPGPWTVRLLQFWEPLGETRFLVLPLTFNRKLPLRKDDASWLHAGPPHN.
GeneID:
64132
Application WB
Background XYLT2 is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases. This enzyme transfers xylose from UDP-xylose to specific serine residues of the core protein and initiates the biosynthesis of glycosaminoglycan chains in proteoglycans including chondroitin sulfate, heparan sulfate, heparin and dermatan sulfate. The enzyme activity, which is increased in scleroderma patients, is a diagnostic marker for the determition of sclerotic activity in systemic sclerosis.The protein encoded by this gene is an isoform of xylosyltransferase, which belongs to a family of glycosyltransferases. This enzyme transfers xylose from UDP-xylose to specific serine residues of the core protein and initiates the biosynthesis of glycosaminoglycan chains in proteoglycans including chondroitin sulfate, heparan sulfate, heparin and dermatan sulfate. The enzyme activity, which is increased in scleroderma patients, is a diagnostic marker for the determition of sclerotic activity in systemic sclerosis. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additiol publications.
Format
Purification:
Affinity Purified
Buffer System:
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Positive controls for Xylosyltransferase 2 / XYLT2 (1 products)

Catalog No. Species Pres. Purity   Source  

XYLT2 Lysate

Western Blot: XYLT2 Lysate [NBL1-17922] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for XYLT2
  Novus Biologicals Inc.
  • LinkedIn