TA338509 Glutamate receptor 3 / GLUR3 antibody

Rabbit Polyclonal Anti-Gria3 Antibody

See related secondary antibodies

Search for all "Glutamate receptor 3 / GLUR3"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Glutamate receptor 3 / GLUR3

Product Description for Glutamate receptor 3 / GLUR3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Glutamate receptor 3 / GLUR3.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Glutamate receptor 3 / GLUR3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms AMPA-selective glutamate receptor, GLURC, GRIA3, GluA3, GluR-3, GluR-C, GluR-K3, Glutamate receptor ionotropic AMPA3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P42263
Immunogen:
The immunogen for Anti-Gria3 antibody is: synthetic peptide directed towards the middle region of Rat Gria3. Synthetic peptide located within the following region: TVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYM.
GeneID:
2892
Application WB
Background Glutamate receptors are the predomint excitatory neurotransmitter receptors in the mammalian brain and are activated in a variety of normal neurophysiologic processes. These receptors are heteromeric protein complexes composed of multiple subunits, arranged to form ligand-gated ion channels. The classification of glutamate receptors is based on their activation by different pharmacologic agonists. The subunit encoded by this gene belongs to a family of AMPA (alpha-amino-3-hydroxy-5-methyl-4-isoxazole propiote)-sensitive glutamate receptors, and is subject to R editing (AGA->GGA; R->G). Altertive splicing at this locus results in different isoforms, which may vary in their sigl transduction properties. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Glutamate receptor 3 / GLUR3 (4 products)

Catalog No. Species Pres. Purity   Source  

Glutamate receptor 3 / GLUR3

Glutamate receptor 3 / GLUR3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Glutamate receptor 3 / GLUR3

Glutamate receptor 3 / GLUR3 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Glutamate receptor 3 / GLUR3

Glutamate receptor 3 / GLUR3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Glutamate receptor 3 / GLUR3

Glutamate receptor 3 / GLUR3 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for Glutamate receptor 3 / GLUR3 (1 products)

Catalog No. Species Pres. Purity   Source  

GRIA3 293T Cell Transient Overexpression Lysate(Denatured)

GRIA3 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.
  • LinkedIn