TA338538 CLCNKA antibody

Rabbit Polyclonal Anti-CLCNKA Antibody

See related secondary antibodies

Search for all "CLCNKA"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Human, Mouse, Porcine, Rat CLCNKA

Product Description for CLCNKA

Rabbit anti Bovine, Human, Mouse, Porcine, Rat CLCNKA.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for CLCNKA

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Chloride channel Ka, Chloride channel protein ClC-Ka, ClC-K1, ClCK1
Presentation Purified
Reactivity Bov, Hu, Ms, Por, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
P51800
Immunogen:
The immunogen for anti-CLCNKA antibody: synthetic peptide directed towards the N terminal of human CLCNKA. Synthetic peptide located within the following region: MEELVGLREGFSGDPVTLQELWGPCPHIRRAIQGGLEWLKQKVFRLGEDW.
GeneID:
1187
Application WB
Background This gene is a member of the CLC family of voltage-gated chloride channels. The encoded protein is predicted to have 12 transmembrane domains, and requires a beta subunit called barttin to form a functiol channel. It is thought to function in salt reabsorption in the kidney and potassium recycling in the inner ear. The gene is highly similar to CLCNKB, which is located 10 kb downstream from this gene. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

  • LinkedIn