TA338542 KCNAB3 antibody

Rabbit Polyclonal Anti-KCNAB3 Antibody

See related secondary antibodies

Search for all "KCNAB3"

0.1 ml / €300.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat KCNAB3

TA338542

More Views

  • TA338542

Product Description for KCNAB3

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat KCNAB3.
Presentation: Purified
Product is tested for Paraffin Sections, Western blot / Immunoblot.

Properties for KCNAB3

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms K(+) channel subunit beta-3, KCNA3B, Kv-beta-3, Voltage-gated potassium channel subunit beta-3
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt
Applications P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O43448
Immunogen:
The immunogen for anti-KCNAB3 antibody: synthetic peptide directed towards the N terminal of human KCNAB3. Synthetic peptide located within the following region: RNLGKSGLRVSCLGLGTWVTFGSQISDETAEDVLTVAYEHGVNLFDTAEV.
GeneID:
9196
Application WB
IHC
Background This gene encodes a member of the potassium channel, voltage-gated, shaker-related subfamily. The encoded protein is one of the beta subunits, which are auxiliary proteins associating with functiol Kv-alpha subunits. The encoded protein forms a heterodimer with the potassium voltage-gated channel, shaker-related subfamily, member 5 gene product and regulates the activity of the alpha subunit. [provided by RefSeq, May 2012].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for KCNAB3 (1 products)

Catalog No. Species Pres. Purity   Source  

KCNAB3

KCNAB3 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for KCNAB3 (1 products)

Catalog No. Species Pres. Purity   Source  

KCNAB3 overexpression lysate

KCNAB3 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn