TA338559 Serotonin receptor 3B (HTR3B) antibody

Rabbit Polyclonal Anti-HTR3B Antibody

See related secondary antibodies

Search for all "Serotonin receptor 3B (HTR3B)"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Serotonin receptor 3B (HTR3B)

TA338559

More Views

  • TA338559
  • TA338559

Product Description for Serotonin receptor 3B (HTR3B)

Rabbit anti Bovine, Canine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat Serotonin receptor 3B (HTR3B).
Presentation: Purified
Product is tested for Immunocytochemistry/Immunofluorescence, Paraffin Sections, Western blot / Immunoblot.

Properties for Serotonin receptor 3B (HTR3B)

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms 5-HT3-B, 5-HT3B, 5-hydroxytryptamine receptor 3B
Presentation Purified
Reactivity Bov, Can, GP, Hu, Ms, Por, Rb, Rt
Applications ICC/IF, P, WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
O95264
Immunogen:
The immunogen for anti-HTR3B antibody: synthetic peptide directed towards the N terminal of human HTR3B. Synthetic peptide located within the following region: PLWACILVAAGILATDTHHPQDSALYHLSKQLLQKYHKEVRPVYNWTKAT.
GeneID:
9177
Application WB
IHC
IF
Background The product of this gene belongs to the ligand-gated ion channel receptor superfamily. This gene encodes subunit B of the type 3 receptor for 5-hydroxytryptamine (serotonin), a biogenic hormone that functions as a neurotransmitter, a hormone, and a mitogen. This receptor causes fast, depolarizing responses in neurons after activation. It is not functiol as a homomeric complex, but a pentaheteromeric complex with subunit A (HTR3A) displays the full functiol features of this receptor. [provided by RefSeq, Aug 2011].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Serotonin receptor 3B (HTR3B) (1 products)

Catalog No. Species Pres. Purity   Source  

Serotonin receptor 3B (HTR3B)

Serotonin receptor 3B (HTR3B) Human
  Abnova Taiwan Corp.
  • LinkedIn