TA338590 NMUR2 antibody

Rabbit Polyclonal Anti-NMUR2 Antibody

See related secondary antibodies

Search for all "NMUR2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human NMUR2

Product Description for NMUR2

Rabbit anti Human NMUR2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NMUR2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms G-protein coupled receptor TGR-1, NMU2R, NMUR-2, Neuromedin-U receptor 2, TGR1
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9GZQ4
Immunogen:
The immunogen for anti-NMUR2 antibody: synthetic peptide directed towards the N terminal of human NMUR2. Synthetic peptide located within the following region: MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSV.
GeneID:
56923
Application WB
Background This gene encodes a protein from the G-protein coupled receptor 1 family. This protein is a receptor for neuromedin U, which is a neuropeptide that is widely distributed in the gut and central nervous system. This receptor plays an important role in the regulation of food intake and body weight. [provided by RefSeq, Jul 2008].
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NMUR2 (9 products)

Catalog No. Species Pres. Purity   Source  

NMUR2

NMUR2 Human
  Abnova Taiwan Corp.

NMUR2

NMUR2 Human
  Abnova Taiwan Corp.

NMUR2

NMUR2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NMUR2

NMUR2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NMUR2

NMUR2 Human Purified
  Abnova Taiwan Corp.

NMUR2

NMUR2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NMUR2

NMUR2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

NMUR2

NMUR2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NMUR2

NMUR2 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for NMUR2 (2 products)

Catalog No. Species Pres. Purity   Source  

NMUR2 Lysate

Western Blot: NMUR2 Lysate [NBL1-13698] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for NMUR2
  Novus Biologicals Inc.

NMUR2 overexpression lysate

NMUR2 overexpression lysate
0.1 mg / €295.00
  OriGene Technologies, Inc.
  • LinkedIn