TA338601 STRA6 antibody

Rabbit Polyclonal Anti-STRA6 Antibody

See related secondary antibodies

Search for all "STRA6"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Human STRA6

Product Description for STRA6

Rabbit anti Human STRA6.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for STRA6

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FLJ12541, PP14296, Stimulated by retinoic acid gene 6 protein homolog
Presentation Purified
Reactivity Hu
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BX79
Immunogen:
The immunogen for anti-STRA6 antibody: synthetic peptide directed towards the N terminal of human STRA6. Synthetic peptide located within the following region: MSSQPAGNQTSPGATEDYSYGSWYIDEPQGGEELQPEGEVPSCHTSIPPG.
GeneID:
64220
Application WB
Background STRA6 may act as a high-affinity cell-surface receptor for the complex retinol-retinol binding protein (RBP/RBP4). STRA6 acts by removing retinol from RBP/RBP4 and transports it across the plasma membrane, where it can be metabolized. This mechanism does not depend on endocytosis. STRA6 binds to RBP/RBP4 with high affinity. STRA6 increases cellular retinol uptake from the retinol-RBP complex.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for STRA6 (2 products)

Catalog No. Species Pres. Purity   Source  

STRA6

STRA6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

STRA6

STRA6 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for STRA6 (2 products)

Catalog No. Species Pres. Purity   Source  

STRA6 293T Cell Transient Overexpression Lysate(Denatured)

STRA6 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

STRA6 Lysate

Western Blot: STRA6 Lysate [NBL1-16566] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for STRA6
  Novus Biologicals Inc.
  • LinkedIn