TA338602 HERPUD2 antibody

Rabbit Polyclonal Anti-HERPUD2 Antibody

See related secondary antibodies

Search for all "HERPUD2"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish HERPUD2

Product Description for HERPUD2

Rabbit anti Bovine, Canine, Equine, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish HERPUD2.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for HERPUD2

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms FLJ22313, Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 2 protein
Presentation Purified
Reactivity Bov, Can, Eq, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9BSE4
Immunogen:
The immunogen for anti-HERPUD2 antibody: synthetic peptide directed towards the N terminal of human HERPUD2. Synthetic peptide located within the following region: MDQSGMEIPVTLIIKAPNQKYSDQTISCFLNWTVGKLKTHLSNVYPSKPL.
GeneID:
64224
Application WB
Background HERPUD2 could be involved in the unfolded protein response (UPR) pathway.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for HERPUD2 (3 products)

Catalog No. Species Pres. Purity   Source  

HERPUD2

HERPUD2 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

HERPUD2

HERPUD2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

HERPUD2

HERPUD2 Human Purified 12.5% SDS-PAGE Stained with Coomassie Blue.
  Abnova Taiwan Corp.

Positive controls for HERPUD2 (2 products)

Catalog No. Species Pres. Purity   Source  

HERPUD2 293T Cell Transient Overexpression Lysate(Denatured)

HERPUD2 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

HERPUD2 Lysate

Western Blot: HERPUD2 Lysate [NBL1-11510] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for HERPUD2
  Novus Biologicals Inc.
  • LinkedIn