TA338604 RHBDF1 antibody

Rabbit Polyclonal Anti-RHBDF1 Antibody

See related secondary antibodies

Search for all "RHBDF1"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish RHBDF1

TA338604

More Views

  • TA338604

Product Description for RHBDF1

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish RHBDF1.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for RHBDF1

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms C16orf8, Rhomboid 5 homolog 1, Rhomboid family member 1
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q96CC6
Immunogen:
The immunogen for anti-RHBDF1 antibody: synthetic peptide directed towards the N terminal of human RHBDF1. Synthetic peptide located within the following region: KDWEKAPEQADLTGGALDRSELERSHLMLPLERGWRKQKEGAAAPQPKVR.
GeneID:
64285
Application WB
Background RHBDF1 is a seven-transmembrane protein with a long N-termil cytoplasmic extension that comprises half of the polypeptide sequence, and is found in the endoplasmic reticulum and Golgi, but not on the cell surface. RHBDF1 has a pivotal role in sustaining growth sigls in epithelial cancer cells and thus may serve as a therapeutic target for treating epithelial cancers.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for RHBDF1 (3 products)

Catalog No. Species Pres. Purity   Source  

RHBDF1

RHBDF1 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

RHBDF1

RHBDF1 Human Purified
  Abnova Taiwan Corp.

RHBDF1

RHBDF1 Human Purified
  Abnova Taiwan Corp.

Positive controls for RHBDF1 (2 products)

Catalog No. Species Pres. Purity   Source  

RHBDF1 Lysate

Western Blot: RHBDF1 Lysate [NBL1-15343] - Western Blot experiments. 
Left-Control; Right -Over-expression Lysate for RHBDF1
  Novus Biologicals Inc.

RHBDF1 overexpression lysate

RHBDF1 overexpression lysate
  OriGene Technologies, Inc.
  • LinkedIn