TA338607 Cadherin-24 antibody

Rabbit Polyclonal Anti-CDH24 Antibody

See related secondary antibodies

Search for all "Cadherin-24"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Cadherin-24

Product Description for Cadherin-24

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Porcine, Rabbit, Rat, Zebrafish Cadherin-24.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for Cadherin-24

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms CDH11L, CDH24
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Por, Rb, Rt, Ze
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q86UP0
Immunogen:
The immunogen for anti-CDH24 antibody: synthetic peptide directed towards the N terminal of human CDH24. Synthetic peptide located within the following region: NPPIFPLGPYHATVPEMSNVGTSVIQVTAHDADDPSYGNSAKLVYTVLDG.
GeneID:
64403
Application WB
Background Cadherins are calcium dependent cell adhesion proteins. They preferentially interact with themselves in a homophilic manner in connecting cells; cadherins may thus contribute to the sorting of heterogeneous cell types. Cadherin-24 mediate strong cell-cell adhesion.
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for Cadherin-24 (1 products)

Catalog No. Species Pres. Purity   Source  

Cadherin-24 (transcript variant 1)

Cadherin-24 Human > 80 %
Preparation: Recombint protein was captured through anti-DDK affinity column followed by conventiol chromatography steps.
Purity Detail: > 80% as determined by SDS-PAGE and Coomassie blue staining.
HEK293 cells
20 µg / €748.00
  OriGene Technologies, Inc.

Positive controls for Cadherin-24 (1 products)

Catalog No. Species Pres. Purity   Source  

CDH24 overexpression lysate

CDH24 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn