TA338611 NDST4 antibody

Rabbit Polyclonal Anti-NDST4 Antibody

See related secondary antibodies

Search for all "NDST4"

0.1 ml / €360.00
Please visit the country specific website of OriGene Technologies or contact your local Distributor to buy this product.

Quick Overview

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat NDST4

Product Description for NDST4

Rabbit anti Bovine, Canine, Equine, Guinea Pig, Human, Mouse, Rabbit, Rat NDST4.
Presentation: Purified
Product is tested for Western blot / Immunoblot.

Properties for NDST4

Product Category Primary Antibodies
Quantity 0.1 ml
Synonyms Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4, HSST4
Presentation Purified
Reactivity Bov, Can, Eq, GP, Hu, Ms, Rb, Rt
Applications WB
Clonality Polyclonal
Host Rabbit
Isotype IgG
Shipping to Europe, USA/Canada
PDF datasheet View Datasheet
Manufacturer OriGene Technologies, Inc.

Datasheet Extract

Immunogen
Swiss Prot Num:
Q9H3R1
Immunogen:
The immunogen for anti-NDST4 antibody: synthetic peptide directed towards the middle region of human NDST4. Synthetic peptide located within the following region: YLFLLMHPSIISNLPSPKTFEEVQFFNGNNYHKGIDWYMDFFPTPSNTTS.
GeneID:
64579
Application WB
Background NDST4 is an essential bifunctiol enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (Glcc) of the glycosaminoglycan in heparan sulfate. It modifies the Glcc-GlcA dissacharide repeating sugar backbone to make N-sulfated
Format
Purification:
Protein A purified
Buffer System:
1X PBS with 0.09% (w/v) sodium azide and 2% sucrose.
State:
Purified

Accessory Products

Proteins and/or Positive Controls

Proteins for NDST4 (4 products)

Catalog No. Species Pres. Purity   Source  

NDST4

NDST4 Human Purified
  Abnova Taiwan Corp.

NDST4

NDST4 Human Purified
  Abnova Taiwan Corp.

NDST4

NDST4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

NDST4

NDST4 Human 12.5% SDS-PAGE Stained with Coomassie Blue. in vitro transl.
  Abnova Taiwan Corp.

Positive controls for NDST4 (2 products)

Catalog No. Species Pres. Purity   Source  

NDST4 293T Cell Transient Overexpression Lysate(Denatured)

NDST4 293T Cell Transient Overexpression Lysate(Denatured)
  Abnova Taiwan Corp.

NDST4 overexpression lysate

NDST4 overexpression lysate
0.1 mg / €495.00
  OriGene Technologies, Inc.
  • LinkedIn